Inventions in Milk Protein Foods From category
Introduction
Milk Protein Foods From is one of those areas that honestly has a lot of new inventions coming up almost every day. Of course, quality is more important than quantity but dont' forget about the element of chance. In higher sample size there is that higher probablity of somethign useful coming up.
Patented Inventions in Milk Protein Foods From
-
Novel Triglyceride and Fuel Compositions
Here are few examples in this category: A Novel Triglyceride and Fuel Compositions, which seems to be dated Mon, 30 Nov 2009 00:00:00 -0800. This one is quite interesting for Milk Protein Foods From category. First of all it is very futuristic; I guess everything new that is invented has to be in one way or another futuristic. Anyways, the point here is that this invention has some good potential for future. Inventors of this project were Solazyme, Inc.. The idea behind the it is very odd in a good way.
Let’s say see what the actual authors say about them: .
Here is its drawing
-
Mutant EGIII cellulase, DNA encoding such EGIII compositions and methods for ...
Here are few examples in this category: A Mutant EGIII cellulase, DNA encoding such EGIII compositions and methods for ..., which seems to be dated Fri, 04 Aug 2000 00:00:00 -0700. This one is quite interesting for Milk Protein Foods From category. First of all it is very futuristic; I guess everything new that is invented has to be in one way or another futuristic. Anyways, the point here is that this invention has some good potential for future. Inventors of this project were Genencor International, Inc.. The idea behind the it is very odd in a good way.
Let’s say see what the actual authors say about them: Figure 1: Amino Acid Sequence of Mature EGIII Protein QTSCDQWATFTGNGYTVSNNLWGASAGSGFGCVTAVSLSGGASWHADWQWSGGQNNVKSY ....
Here is its drawing
-
Dried Food Compositions
Here are few examples in this category: A Dried Food Compositions, which seems to be dated Thu, 03 Apr 2008 00:00:00 -0700. This one is quite interesting for Milk Protein Foods From category. First of all it is very futuristic; I guess everything new that is invented has to be in one way or another futuristic. Anyways, the point here is that this invention has some good potential for future. Inventors of this project were SOLAE, LLC. The idea behind the it is very odd in a good way.
Let’s say see what the actual authors say about them: ... Examples of omega-3 fatty acids include alpha-linolenic acid (18:3, ALA), stearidonic acid (18:4), eicosatetraenoic acid (20:4), eicosapentaenoic acid ....
Here is its drawing
-
Food product with a fibrous texture obtained from whey proteins
Here are few examples in this category: A Food product with a fibrous texture obtained from whey proteins, which seems to be dated Thu, 20 Jun 2002 00:00:00 -0700. This one is quite interesting for Milk Protein Foods From category. First of all it is very futuristic; I guess everything new that is invented has to be in one way or another futuristic. Anyways, the point here is that this invention has some good potential for future. Inventors of this project were Bongrain S.A.. The idea behind the it is very odd in a good way.
Let’s say see what the actual authors say about them: Illllllllllllllllllllllllllllllllllllllllllllllllll US006565900B2 (12) United States Patent ao) Patent No.: us 6565900 B2 Roussel et al..
Here is its drawing
Recent Coding Future Posts:
Here are couple of things you never heard of Google glasses and Holoflector. These are I would say the first important step towards viable augmented reality future. They are from rival companies Google and Microsoft. Without further ado,:
...MoreWhat future technology would you like to have today ? If Aladdin’s jenni gave you three wishes, what would be your wishes? Here is my list: 1. Super brain Yes, I wan to be able to read and absorb the entire content of internet in light speed. In fact, I want to be the internet. Sounds too far [...]
...MoreAre you up for a quiet little ice age? Then pack your bags, based on recent observations, in our near future, we might have one. It seems like our Sun is about to become quiet. Not forever though, just for a while its activity will be lower. A little explanation: To most of us sun is a [...]
...MoreDon’t know what these words are? Soon you will have to memorize them, that is if you really want to know all periodic elements by heart. It seems like after three years of review our beloved chemists and physicists finally decided that they will be adding element 114 and 116 to the periodic table of [...]
...MoreIn 2009 Apple purchased Lala, a cloud based music service. After that everybody has been waiting for the day when Apple does something with it. Today is the day. They have announced the iCloud. Hold on to your paints, it is music in the clouds, and best of all it is FREE (yes they announced [...]
...MoreSearching inventions by utalizing United States Patent classification and Google patent search.
More Invention Categories :
Search Categories:Next>>